PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G272700.5.p
Common NameSETIT_017977mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 264aa    MW: 28894.5 Da    PI: 9.041
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G272700.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-134084147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Seita.1G272700.5.p 40 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 84
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.03E-173490IPR009057Homeodomain-like
PROSITE profilePS5129415.4083589IPR017930Myb domain
TIGRFAMsTIGR015571.0E-183887IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.9E-73890IPR009057Homeodomain-like
SMARTSM007175.3E-113987IPR001005SANT/Myb domain
PfamPF002491.9E-114084IPR001005SANT/Myb domain
CDDcd001671.15E-84285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MVSASTPPLP PPTQPQSDAA GSGEDASKKV RKPYTITKSR ESWTEQEHDK FLEALQLFDR  60
DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK NGTSEHVPPP RPKRKAAHPY PQKASKNEPN  120
YGLKTDSSSI HRNSGMNATV SSWAVSSIPP AVASSMVKDL GPGTLGPNNF CSSSTEGPPR  180
TWQPGETNDQ INQVPSLRLM PDFAQVYSFL GSVFDPSTSG HLQKLKEMNP IDVETALLLM  240
RNLSINLTSP DFEDQVSSST TCL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794460.0HF679446.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB40 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953450.10.0PREDICTED: protein REVEILLE 6-like isoform X2
RefseqXP_004953453.10.0PREDICTED: protein REVEILLE 6-like isoform X5
SwissprotQ8H0W34e-95RVE6_ARATH; Protein REVEILLE 6
TrEMBLK3YV210.0K3YV21_SETIT; Uncharacterized protein
STRINGSi017977m1e-179(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-79MYB_related family protein